SelectScience
  • (Opens in new tab)
  • (Opens in new tab)
  • (Opens in new tab)
Join Free
  1. Home
  2. /Antibody
  3. /Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)
Product & ReviewsAntibodies

Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)

CUSABIO
0.0/5.0
|0 Reviews|Write your own Review

Product Details

Cat. No.
CSB-EP010706HU(M11)
Type
Other Products
Host
Human
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Buy Now
CUSABIO

Receive your quote directly from the manufacturer.

Product Overview

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)

CUSABIO
0.0/5.0
|0 Reviews
Buy Now

Links

CUSABIO

Why request a quote through SelectScience?

  • EasyIt’s quick and simple to do
  • FastYour inquiry will be delivered straight to the manufacturer
  • FreeYou’re under no obligation
  • SecureWe only pass your details on to trusted suppliers at your request
  • Save timeSubmit your details once and make multiple inquiries

  • (Opens in new tab)
  • (Opens in new tab)
  • (Opens in new tab)
Fields & Topics
  • Life Sciences
  • Drug Discovery & Development
  • Clinical Diagnostics
  • Environmental
  • Materials
  • Food & Beverage
  • General Lab
  • Lab Automation
  • Lab Informatics
  • Separations
  • Spectroscopy
  • Forensics
  • Cannabis Testing
Products & Reviews
  • All Products & Reviews
  • All Antibodies & Reviews
  • Write a Review
News & Insights
  • News & Articles
  • Events & Summits
  • Webinars
  • Editorial features
  • Immersive Content
Resources
  • Applications & Methods
  • How-to-Buy eBooks
  • Videos
Sponsors / Client
  • Media Kit
  • Reviews Program
  • Insights for Marketers
  • Seal of Quality
  • Case Studies
  • Testimonials
  • Editorial & Production Guidelines
  • Terms & Conditions of Business
  • Data Sharing Annex
About us
  • About Us
  • Careers
  • Contact Us
  • Corporate Social Responsibility Statement

SelectScience Brands

The Scientists Channel Logo
Scientists Choice Awards Logo

Awards

Queens Awards for Enterprise Logo
UK Life Sciences Award Logo
  • Terms
  • Cookie Policy
  • Acceptable use policy
  • Privacy

© SelectScience 2025

Login

New to SelectScience?
Register for free today

  • Summary
  • Reviews

Description

Expression region:MHHHHHHYGRKKRRQRRRGIGEVLHELADDLPELQSWIKAAQQLGGGGSGFLGPAPAPAPAPA+2-218aa;Full Length of Mature Protein.Tag:N-terminal 6xHis-tagged

Biological Information

  • Host: Human
  • Source: E.coli recombinant expression
  • Gene: P00492

Handling

  • Quantity: 20ug
  • Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Applications

  • SDS-PAGE (SDS-PAGE)
  • ELISA (ELISA)
  • Western Blotting (WB)
  • Immunoassay (IA)
Specificity rating
Sensitivity rating
Quality rating
Be the first to leave a review